Hak Paten

Diposting pada

Selamat datang di Pakdosen.co.id, web digital berbagi ilmu pengetahuan. Kali ini PakDosen akan membahas tentang Hak Paten? Mungkin anda pernah mendengar kata Hak Paten? Disini PakDosen membahas secara rinci tentang pengertian, subjek, ruang lingkup, permohonan, pengalihan, lisensi, pembatalan, pelaksanaan dan hukum. Simak Penjelasan berikut secara seksama, jangan sampai ketinggalan.

Hak Paten

Pengertian Hak Paten

Istilah paten bermula dari bahasa Latin yang berarti dibuka dan berlawanan dengan Latent yang berarti terselubung, oleh karenanya bahwa suatu penemuan yang mendapatkan paten menjadi terbuka untuk diketahui oleh umum. Dengan terbuka tersebut tidak berarti setiap orang bisa mempraktikan penemuan bisa didayagunakan oleh orang lain. Baru setelah habis masa perlindungan patennya penemuan tersebut menjadi milik umum (public domain), pada saat inilah benar-benar terbuka. Dengan terbukanya suatu penemuan yang baru, memberi informasi yang diperlukan bagi pengembangan teknologi selanjutnya berdasarkan penemuan tersebut dan untuk memberi petunjuk kepada mereka yang berminat dalam mengeksploitasi penemuan itu.


Berdasarkan penjelasan sebelumnya maka dengan demikian paten adalah hak istimewa (eksklusif) yang diberikan kepada seorang penemu (inventor) atas hasil penemuan (invention) yang dilakukan di bidang teknologi, baik yang berbentuk produk atau proses saja, atas dasar hak istimewa tersebut, orang lain dilarang untuk mendayagunakan hasil penemuannya terkecuali atas izinnya atau penemu sendiri melaksanakan hasil penemuannya. Hak istimewa ini diberikan untuk jangka waktu tertentu, setelah itu hasil penemuannya menjadi milik umum. Dengan demikian setiap hasil penemuan yang telah dipatenkan, penemuannya atau mendayagaunakan hasil temuannya tersebut. Paten diberikan atas dasar permohonan yang dimohonkan oleh pemohon,dan apabila paten tersebut diterima diwajibkan oleh pemegangnya untuk melaksanakan patennya tersebut. Bagi penemu diberikannya suatu hak perlindungan terhadap penemuannya ini atau dapat kita sebut dengan istilah monopoli dapat dianggap sebagai suatu penghargaan bagi ide intelektualnya.


Subjek Hak Paten

Mengenai subjek paten Pasal 10 Undang-Undang Paten No. 14 Tahun 2001 menyebutkan:

  1. yangberhakmemperoleh paten adalah inventor atau yang menerima lebih lanjut hak inventor yang bersangkutan;
  2. jika suatu invensi dihasilkan oleh beberapa orang secara bersama-sama hakatas invensi tersebut dimiliki secara bersama-sama oleh para inventor yang bersangkutan.

Selanjutnya dalam Pasal 12 Undang-Undang Paten No. 14 Tahun 2001 disebutkan:

  • pihak yang berhakmemperoleh paten atas suatu invensi yang dihasilkan dalam suatu hubungan kerja adalah pihak yang memberikan pekerjaan tersebut, kecuali perjanjian lain;
  • ketentuansebagaimanadimaksudkandalam ayat (1) juga berlaku terhadap invensi yang dihasilkan baik olehkaryawanmaupunmaupunpekerja yang menggunakan data atau sarana yang tersedia dalam pekerjaannya sekalipun perjanjiantersebuttidakmengharuskannyauntukmenghasilkaninvensi;
  • inventorsebagaimanadimaksudkanpada ayat (1) dan ayat (2) berhak mendapatkan imbalan yang layak dengan memperhatikan manfaat ekonomi yang diperoleh dari invensi tersebut;
  • imbalansebagaimanadimaksudkanpada ayat (3) dapat dibayarkan;
  • dalam jumlah tertentu dan sekaligus;
  • persentase;
  • gabunganantarajumlahtertentu dan sekaligus dengan hadiah atau bonus;
  • gabunganantarapersentasedan hadiah atau bonus;
  • bentuk lain yang disepakati oleh pihak yang bersangkutan yang besarnya ditetapkan oleh pihak-pihak yang bersangkutan;
  • tidakterdapatkesesuaianmengenai cara perhitungan dan penetapan besarnya imbalan, keputusan untuk diberikan oleh Pengadilan Niaga;
  • ketentuansebagaimanadimaksudpada ayat (1), ayat (2) dan ayat (3) sama sekali tidak menghapuskan hak inventor untuk tetap dicantumkan namanya dalam sertifikat paten.

Apabila invensi tersebut ditemukan atas kerja sama, maka hak atas paten tersebut dimiliki secara kolektif. Hak kolektif selain diberikan kepada beberapa orang secara bersama-sama dapat juga diberikan kepada badan hukum. Orang yang pertama kali mengajukan permintaan paten dianggap sebagai inventor. Apabiladikemudianhariterbuktisebaliknya secara kuat dan meyakinkan maka status sebagai inventor tersebut dapat saja berubah sesuai dengan bukti-bukti hukum di pengadilan.

Baca Lainnya :  Biogas adalah

Hak dan kewajiban pemegang paten Pasal 16 UU No. 14 Tahun 2001 menyebutkan:

  1. pemegang paten memilikihakekslusifuntukmelaksanakan paten yang dimilikinya dan melarang pihak lain yang tanpapersetujuannya;
  2. dalam hal paten proses, larangan terhadap pihak lain yang tanpa persetujuan melakukan impor sebagaimana dimaksudkan pada ayat (1) hanya berlaku terhadap impor produk yang semata-mata dihasilkan oleh penggunaan paten proses yang dimilikinya;
  3. dikecualikandariketentuansebagaimana dimaksud pada ayat (1) dan ayat (2) apabila pemakaian paten tersebut untuk kepentingan pendidikan, penelitian, percobaan atau sepanjang tidak merugikan kepentingan yang wajar dari pemegang paten.

Pemegang paten melaksanakan atau melakukan tindakan lainnya yang bersifat pengambilan manfaat ekonomi dari suatu penemuan. Unsur yang terpenting terletak pada aspek perlindungan hukum terhadap pemanfaatan hak tersebut secara menyeluruh dan utuh. Kurang tepat bilamana persoalannya kemudian dipisahkan dalam bentuk ekspor dan impor. Sebab ekspor dan impor adalah masalah tata niaga yang pada era WTO akan menjadi lebih terbuka tanpa dibatasi oleh dinding nasional.


Ruang Lingkup Perlindungan Hak Paten

Ruang Lingkup Hak Paten

Mengenai ruang lingkup perlindungan paten di Indonesia sesuai dengan Undang-Undang No. 14 Tahun 2001 tentang paten, meliputi: penemuan yang dapat diberikan paten, penemuan yang tidak dapat diberikan paten, subjek paten, hak dan kewajiban pemegang paten dan pengecualian terhadap pelaksanaan paten. Mengenai penemuan yang dapat diberikan paten menurut Pasal 2 UU No. 14 Tahun 2001 menegaskan:

  • patendiberikanuntukinvensi yang baru danmengandunglangkahinventifsertadapatditerapkankedalamindustri;
  • suatuinvensimengandunglangkahinventifjikainvensitersebut bagi seseorang yang mempunyai keahlian tertentu di bidang teknik merupakan hal yang tidakdaptdidugasebelumnya;
  • penilaianbahwasuatuinvensi merupakan hal yang tidak dapat diduga sebelumnya harus dilakukan dengan memperhatikan keahlian yang ada pada saat permohonan itu diajukan dengan hak prioritas.

Paten tidak diberikan untuk invensitentang:

  1. proses atau produk yang pengumuman dan penggunaan atau pelaksanaannya bertentangan dengan peraturan perundang-undangan yang berlaku, moralitas agama,ketertibanumuataukesusilaan;
  2. metodepemeriksaan, perawatan, pengobatan dan pembedahan yang diterapkan terhadap manusia atau hewan;
  3. teoridanmetodedibidang ilmu pengetahuan dan matematika;
  4. semuamakhlukhidup, kecuali jasad renik, proses biologisyngesensialuntukmemproduksi tanaman atau hewan.

Paten sebagaimana dimaksud di atas diberikan untuk jangka waktu 20 (dua puluh) tahun terhitung sejak tanggal penerimaan dan jangka waktu tersebut tidak diperpanjang. Adapun untuk untuk paten sederhana  diberikan jangka waktu 10 (sepuluh) tahun terhitung sejak tanggal penerimaan dan jangka waktu tersebut juga dapat diperpanjang.


Permohonan Hak Paten

Paten diberikan berdasarkan atas permohonan dan setiap permohonan hanya dapat diajukan untuk satu invensi atau beberapa invensi yang merupakan satu kesatuan invensi. Satu kesatuan invensi adalah beberapa invensi yang baru dan masih memiliki keterkaitan langkah inventif yang erat. Hal-hal yang harus dimuat dalam surat permohonan, yaitu:

  • tanggal, bulan, dan permohonan;
  • alamat lengkap dan alamat jenis permohonan;
  • nama lengkap dan kewarganegaraan inventor;
  • nama dan alamat lengkap kuasa apabila permohonan diajukan melalui kuasa;
  • surat kuasa khusus, dalam hal permohonan diajukan oleh kuasa;
  • pernyataan permohonan untuk dapat diberi paten;
  • judul invensi;
  • klain yang terkandung dalam invensi;
  • deskripsi tentang invensi, yang secara lengkap memuat keterangan tentang cara melaksanakan invensi;
  • gambar yang disebutkan dalam deskripsi yang diperlukan untuk memperjelas invensi;
  • abstrak invensi.

Selanjutnya atas setiap permohonan paten akan diumumkan oleh pemerintah yang dilakukan dengan menempatkannya dalam Berita Resmi Paten yang diterbitkan secara berkala oleh Ditjen HAKI dan atau menempatkannya pada sarana khusus yang disediakan dengan mudah serta jelas dapat dilihat oleh masyarakat. Atas permohonan yang diajukan, Ditjen HAKI akan memberikan keputusan untuk menyetujui atau menolak permohonan. Untuk paten akan dikeluarkan keputusan paling lama 36 (tiga puluh enam) bulan terhitung sejak tanggal penerimaan. Atas paten yang diberikan, akan diterbitkan sertifikat paten yang merupakan bukti hak atas paten dan berlaku pada tanggal diberikannya sertifikat paten dan berlaku surut sejak tanggal penerimaan. Terhadap permohonan paten yang ditolak dapat diajukan permohonan banding ke Komisi Banding Paten paling lama 3 (tiga) bulan terhitung sejak tanggal pengiriman surat pemberitahuan penolakan permohonan. Komisi Banding Paten merupakan badan khusus yang independen dan berada di lingkungan Departemen Kehakiman.

Baca Lainnya :  Contoh Membuat Proposal Kegiatan

Pengalihan dan Lisensi Hak Paten

Seperti diketahui bahwa paten pada dasarnya adalah hak milikperseorangan yang tidak berwujud dan timbul karena kemampuan intelektual manusia. Sebagaimana hak milik tentunya paten dapat dialihkan sebagian atau seluruhnya kepada pihak lain sebagaimana ditegaskan dalam Pasal 66 yang dapat terjadi karena beberapa hal yaitu:

  1. Pewarisan
  2. Hibah
  3. Wasiat
  4. Perjanjiantertulis
  5. Sebab lain yang dibenarkan oleh peraturan perundang-undangan.

Pengalihantersebuttentunyatidak menghapus hak inventor untuk tetap dicantumkannamadanidentitasnyadalam paten yang bersangkutan. Hak ini disebut hak moral.

Beberapa dari pengalihan paten yang pemilikan haknya juga beralih, pemegang paten juga berhak memberikan lisensi kepada pihak lain berdasarkan perjanjian lisensi. Lisensi paten merupakan suatu perjanjian yang pada dasarnya hanya pemberian hak untuk menikmati manfaat ekonomi dari paten dalam jangka waktu dan syarat-syarat tertentu. Lingkup lisensi meliputi semua perbuatan selama jangka waktu lisensi diberikan dan berlaku untuk seluruh wilayahnegara RI. Dalam perjanjian lisensi tidak boleh memuat ketentuan baik langsung maupun tidak langsung yang merugikan perekonomian Indonesia atau memuat pembatasan yang menghambat kemampuan bangsa Indonesia dalam menguasai dan mengembangkanteknologipadaumunyadan yang berkaitan dengan invensi yang diberi paten. Setiap pihak dapat mengajukan permohonan lisensi-wajibkepadaDitjen HAKI untukmelaksanakan paten setelah lewat waktu 36 bulan terhitungsejaktanggalpemberian paten. Permohonan tersebut hanya dapat dilakukan dengan alasan bahwa paten yang bersangkutan tidak dilaksanakan atau dilaksanakan tidak sepenuhnya di Indonesia oleh pemegang paten.


Sebagai konsekuensi dari pelaksanaan lisensi-wajib, tentu akan disertai dengan pembayaran royalti oleh penerima lisensi-wajib kepada pemegang paten. Royalti tersebut dapat berupa uang atau bentuklainnya yang disepakati para pihak. Besar royalti dilakukan dengan memperhatikan tata cara yang lazim digunakan dalam perjanjian lisensi paten atau perjanjian lain yang sejenis yaitu perjanjian yang lazim dibuat dalam rangka pengalihan kemampuan atau pengalihan pengetahuan tentang teknologi yang tidak di patenkan. Lisensi-wajib akan berakhir apabila:

  1. Alasan yang dijadikandasar bagi pemberian lisensi-wajibtidakadalagi;
  2. Penerimalisensi-wajib tidak melaksanakan lisensi-wajib tersebut atau tidak melakukan usaha persiapan yang sepantasnya untuk segera melaksanakannya;
  3. Penerimalisensi-wajib tidak lagi mentaati syarat dan ketentuan lainnya termasuk pembayaran royalti yang ditetapkan dalam pemberian lisensi-wajib.

Pembatalan Hak Paten

Undang-Undang Paten menegaskan bahwa ada 3 (tiga) macam pembatalan paten, yaitu Pertama, karena batal demi hukum, Kedua, batal atas permohonan pemegang paten, dan Ketiga, batal karena adanya gugatan. Paten yang dinyatakan batal demi hukum apabila pemegang paten tidak memenuhi kewajiban membayar biaya tahunan dalam jangka waktu yang ditentukan oleh undang-undang, yang akan diberitahukan secaratertulisolehDitjen HAKI kepadapemegang paten serta penerima lisensi dan mulai berlaku sejak tanggal pemberitahuan tersebut. Paten yang dinyatakan batal demi hukum ini akan dicatat dan diumumkan. Untuk pembatalan paten atas permohonan pemegang paten dilakukanolehDitjen HAKI untukseluruh atau sebagian atas permohonan paten yang diajukan. Atas pembatalan paten ini tidak dapat dilakukan jika penerima lisensi tidak memberikan persetujuan secara tertulis yang dilampirkan pada permohonan pembatalan tersebut.

Baca Lainnya :  Perencanaan Karir adalah

Selanjutnya keputusan pembatalan paten tersebut diberitahukan secaratertulisolehDitjen HAKI sepertihalnya batal demi hukum. Sedangkan untuk pembatalan paten karena gugatan terjadi karena adanya gugatan yang diajukan oleh pihak ketiga kepada pemegang paten melalui Pengadilan Niaga dalam hal paten tersebut sama dengan paten lain yang telah diberikan kepada pihak lain untuk invensi yang sama berdasarkan undang-undang. Gugatan pembatalan dapat juga dilakukan oleh Jaksa terhadap pemegang paten atau penerima lisensi dalam hal pemberian lisensi-wajib ternyata tidak mampu mencegah berlangsungnya pelaksanaan paten dalam jangka waktu 2 (dua) tahun sejak tanggal pemberian lisensi-wajib yang bersangkutan atau sejak tanggal pemberian lisensi-wajib pertama dalam hal diberikan beberapa lisensi-wajib. Akibat hukum dari adanya pembatalan paten adalah :

  • Akanmenghapuskansegalaakibathukum yang berkaitandenganpatendanhal-hal lain yang berasal dari paten tersebut
  • Penerimalisensitetapberhak melaksanakan lisensi yang dimilikinya sampai dengan berakhirnya jangka waktu yang ditetapkan dalam perjanjian lisensi yaitu penerima lisensi yang dibatalkan  karena alasan paten yang digugat pembatalannya sama dengan paten lain yang telah diberikan kepada pihak lain untuk invensi yang sama berdasarkan undang-undang
  • Penerimaanlisensitidakwajib meneruskan pembayaran royalti yang seharusnya masih wajib dilakukan kepada pemegang paten yang patennyadibatalkan, tetapimengalihkan pembayaran royaltiuntuk sisa jangka waktu lisensi yang dimilikinya kepada pemegang paten yang berhak. Apabila pemegang paten sudah menerima sekaligus royalti dari penerima lisensi, pemegang paten tersebut wajib mengembalikan jumlah royalti sesuai dengan sisajangkawaktupengunalisensikepadapemegangpaten  yang berhak.

Pelaksanaan Hak Paten Oleh Pemerintah

Pasal 99 Undamg-Undang Paten menegaskanapabila pemerintah berpendapat bahwa suatu paten di Indonesia sangat penting artinya bagi pertahanan keamanan negara dan kebutuhan sangat mendesak untuk kepentingan masyarakat, pemerintah dapat melaksanakan sendiri paten yang bersangkutan yang akan ditetapkan dengan keputusan presiden. Contoh invensi yang terkait dengan pertahanandan keamanan negara antara lain bahanpeledak, senjatadanamunisi. Sedangkanuntukkebutuhan yang sangatmendesak bagi kepentingan masyarakat mencakup antara lain bidang kesehatan seperti obat-obat yang masih dilindungi paten di Indonesia yang diperlukan untuk menanggulangipenyakit yang berjangkitsecaraluas; bidang pertanian misalnya pestisida yang sangat dibutuhkan untuk menanggulangi gagalnya hasil panen secara nasional yang disebabkan oleh hama. Pemerintah akan memberikan imbalan yang wajar kepada pemegang paten. Seandainya pemegang paten tidak setuju atas besarnya imbalan yang ditetapkan oleh pemerintah, pemegang paten dapat megajukangugatanatasketidaksetujuannyakepadaPengadilanNiaga, namun gugatan tersebut tidak menghentikan pelaksanaan paten oleh pemerintah.


Hukum yang Mengatur Hak Paten

Pasal 1 angka 1 UU Paten menyatakan bahwa hak paten adalah hak eksklusif yang diberikan oleh negara kepada inventor atas hasil invensinya di bidang teknologi, yang untuk selama waktu tertentu melaksanakan sendiri invensinya tersebut atau memberikan persetujuannya kepada pihak lain untuk melaksanakannya. Hak eksklusif adalah hak yang mendasari pemegang paten untuk untuk memproduksi, menggunakan, menjual, dan lain sebagainya yang berkaitan dengan penjualan barang tersebut. Adapun pengertian paten dalam UU Paten, sesuai dengan apa yang dirumuskan dalam Pasal 1 angka 1 Undang-Undang Paten Tahun 1997 yaitu hak eksklusif yang diberi oleh negara terhadap inventor atas invensinya di bidang teknologi dalam jangka waktu yang tertentuuntuk dapat melaksanakan penemuannya secara sendiri, atau orang lain yang mendapatkan izin dari inventor. dan Pasal 1 angka 2 Undang-Undang Paten Tahun 1997 yang menyatakan penemuan adalah kegiatan pemecahan masalah tertentu di bidang


Demikian Penjelasan Materi Tentang Hak Paten : Pengertian, Subjek, Ruang Lingkup, Permohonan, Pengalihan, Lisensi, Pembatalan, Pelaksanaan dan Hukum Semoga Materinya Bermanfaat Bagi Siswa-Siswi.